"context" : "", "actions" : [ "action" : "rerender" Note that the exported configuration file exposes secret keys, passwords, and other sensitive data in clear text (because "action" : "rerender" "action" : "rerender" You cannot wipe away the device's configuration and replace As a reminder for those who arent familiar with Policy, The industrys first no-cost firewall assessment tool that quickly identifies configuration errors and high-risk rules, We sat down with FireMons MSP & Cloud Operations Strategic Account Executive, Steve Martinez to discuss the latest MSP landscape. } ', 'ajax'); If you specify a key, you will need to use the key to open the zip file after you download it to your workstation. First of all we need to be sure that the REST API service is enabled on FMC because the script works only via API. "context" : "", ] LITHIUM.Placeholder(); ] "action" : "pulsate" "actions" : [ "actions" : [ Exports firewall rules to a CSV or JSON file. "actions" : [ can edit the file prior to importing it back into the same device or a different device. "event" : "removeThreadUserEmailSubscription", { ","topicMessageSelector":".lia-forum-topic-message-gte-5","focusEditor":false,"hidePlaceholderShowFormEvent":"LITHIUM:hidePlaceholderShowForm","formWrapperSelector":"#inlinemessagereplyeditor_0 .lia-form-wrapper","reRenderInlineEditorEvent":"LITHIUM:reRenderInlineEditor","ajaxBeforeSendEvent":"LITHIUM:ajaxBeforeSend:InlineMessageReply","element":"input","clientIdSelector":"#inlinemessagereplyeditor_0","loadAutosaveAction":false,"newPostPlaceholderSelector":".lia-new-post-placeholder","placeholderWrapperSelector":"#inlinemessagereplyeditor_0 .lia-placeholder-wrapper","messageId":56151,"formSelector":"#inlinemessagereplyeditor_0","expandedClass":"lia-inline-message-reply-form-expanded","expandedRepliesSelector":".lia-inline-message-reply-form-expanded","newPostPlaceholderClass":"lia-new-post-placeholder","editorLoadedEvent":"LITHIUM:editorLoaded","replyEditorPlaceholderWrapperCssClass":"lia-placeholder-wrapper","messageActionsClass":"lia-message-actions","cancelButtonSelector":"#inlinemessagereplyeditor_0 .lia-button-Cancel-action","isGteForumV5":true,"messageViewWrapperSelector":".lia-threaded-detail-display-message-view","disabledReplyClass":"lia-inline-message-reply-disabled-reply"}); certificate types), object (all object/group types that would be listed in the device "}); } }, } { .PARAMETER Name. }); You can then download the zip file to your workstation. { "action" : "pulsate" "disallowZeroCount" : "false", You can use an export file to restore the configuration to To export all the rules contained in an Access Control Policy you should use a couple of, # Loop through access control rules in http response object, I hope that this post about how to Access Control Policy from Cisco FMC, How to export Access Control Policy from Cisco FMC. { LITHIUM.InlineMessageEditor({"ajaxFeebackSelector":"#inlinemessagereplyeditor_0 .lia-inline-ajax-feedback","submitButtonSelector":"#inlinemessagereplyeditor_0 .lia-button-Submit-action"}); }, } { } { { { { All port forwarding rules2. All public IP addresses5. In FMC, go to Policies > Access Control. "selector" : "#messageview", For example, to export all network objects, plus an access rule named myaccessrule, and two objects identified by UUID, you Once done we are ready to launch our GET. "}); "actions" : [ { $search.find('input.search-input').keyup(function(e) { { Specify true to keep the file, false to have the file deleted from the threat }); you must specify a non-empty encryptionKey attribute. for a PARTIAL_EXPORT job. If you do not want to encrypt the file, omit this field and specify "doNotEncrypt": ] "initiatorDataMatcher" : "data-lia-message-uid" Because you can edit or even manually create an export file, you can remove all objects except those you want to import into The other option would be to use the migration utilities to export the configuration, do a fresh install of R77.30 in a VM, migrate import the config, and use the tool in sk64501. "event" : "expandMessage", ] Alternatively, you can use GET /jobs/configimportstatus/{objId} to get status of one import job. "actions" : [ "context" : "envParam:entity", { defense configuration. A name for the export job. { entityIdsA comma-separated list of the identities of a set of starting-point objects, enclosed in [brackets]. "action" : "rerender" "initiatorBinding" : false, "showCountOnly" : "false", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:sortLabelsWidget","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#labelsTaplet","action":"sortLabelsWidget","feedbackSelector":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.labelstaplet:sortlabelswidget?t:ac=board-id/security/message-id/14315/thread-id/14315&t:cp=labels/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"litM22QURR1mpWv0INCYOdX8JmEneP5fz3WRZf2Okhg. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "event" : "MessagesWidgetMessageEdit", "quiltName" : "ForumMessage", } Primarily, this is for recovering the last good could you be more specific which policies you want it. "context" : "envParam:quiltName", "event" : "unapproveMessage", } "actions" : [ "actions" : [ or imported. ] Excel is not friendly to CSV files). Comments are not allowed in the file. "actions" : [ }, Object references are resolved based on object type and name, or object type and old name, or object type and parent name. If an object you export as CSV with Export-Csv or ConvertTo-Csv has property values that contain a collection (array) of values, these values are stringified via their .ToString() method, which results in an unhelpful representation.. "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", Sometimes its the little things that make the biggest difference. "event" : "ProductAnswer", } on the threat } You might also need to specify index for these objects. } You must specify the type and name attributes in the object data. { value from the response body to your POST /action/configimport call. Non stiamo parlando di un prodotto o di una tecnologia, per cui se qualcuno dovesse presentarsi alla vostra porta con la classica affermazione ti vendo il SASE! can then export the pending changes, and import those changes into device B. } "action" : "rerender" } "event" : "ProductAnswerComment", 2). You may choose another option from the dropdown menu. ] Can we export policies from FMC in pdf or csv format for audit purpose. "action" : "rerender" "}); Unfortunately on FMC you can not download Access Control Policy in a CSV file and the only way is to write an Excel file. "event" : "removeThreadUserEmailSubscription", { All rights reserved. FirepowerPolicyToCSV. Solution. ] "context" : "envParam:quiltName,product,contextId,contextUrl", ] { Are you sure you want to proceed? { "action" : "rerender" end of policy as the last rule. for example, to the IP addresses for each interface. Specify true to start the deployment job automatically. { Export List of Firewall Rules in CSV mronald87 over 9 years ago For audits we've traditionally taken screenshots of all our firewall rules in the web console, but that's a pretty inefficient and time-consuming. { } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#threadeddetaildisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#threadeddetaildisplaymessageviewwrapper_0","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddetaildisplay.threadeddetailmessagelist.threadeddetaildisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/security/message-id/14315/thread-id/14315","ajaxErrorEventName":"LITHIUM:ajaxError","token":"7iLEurfaznb9tuyMp0Ya4UuROWPRLdGOE6KBmBHflMA. $('.cmp-header__search-toggle').each(function() { ] In some cases, we offer a couple of options such as Expanded or Collapsed. "initiatorBinding" : true, The larger the configuration, the more time the job will require. manager, threat If you configured remote access VPN, the AnyConnect packages and any other referenced files, such as client profile XML files, "action" : "rerender" }, If you specify an encryption key, it is masked in the response. "actions" : [ "event" : "addThreadUserEmailSubscription", []. ","disabledLink":"lia-link-disabled","menuOpenCssClass":"dropdownHover","menuElementSelector":".lia-menu-navigation-wrapper","dialogSelector":".lia-panel-dialog-trigger","messageOptions":"lia-component-message-view-widget-action-menu","closeMenuEvent":"LITHIUM:closeMenu","menuOpenedEvent":"LITHIUM:menuOpened","pageOptions":"lia-page-options","clickElementSelector":".lia-js-click-menu","menuItemsSelector":".lia-menu-dropdown-items","menuClosedEvent":"LITHIUM:menuClosed"}); "actions" : [ Whether to allow the import job to start if there are existing pending changes. I believe you can use the cp_merge utility to do this. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_1","feedbackSelector":".InfoMessage"}); { Is there a way i can do it . LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderLoadMoreMessages","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#threadeddetailmessagelist .lia-load-fetch","action":"renderLoadMoreMessages","feedbackSelector":"#ajaxFeedback","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddetaildisplay.threadeddetailmessagelist:renderloadmoremessages?t:ac=board-id/security/message-id/14315/thread-id/14315","ajaxErrorEventName":"LITHIUM:ajaxError","token":"gXBDXKy0Y47snhU8RwhnRGd3l9Mls2MVnakm5Ay5VbI. LITHIUM.AutoComplete({"options":{"triggerTextLength":4,"updateInputOnSelect":true,"loadingText":"Searching","emptyText":"No Matches","successText":"Results:","defaultText":"Enter a search word","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_10f5b27fc4c938b', 'disableAutoComplete', '#ajaxfeedback_10f5b27f97c75be_0', 'LITHIUM:ajaxError', {}, 'ZqHzN_UlB8zL0w3myDbXAf38-y0ok0PABQIU3ZVgt20. { "action" : "rerender" }, { "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_4","feedbackSelector":".InfoMessage"}); You need to specify this ] { "useTruncatedSubject" : "true", } Center. "action" : "rerender" Our solutions have helped more than 1,700 organizations around the world gain visibility into and control over their complex network security infrastructures. }, "event" : "AcceptSolutionAction", } "event" : "ProductMessageEdit", Export - FirePOWER Policies Go to solution Fantas Beginner Options 04-21-2020 02:08 PM Hi, Can we export policies from FMC in pdf or csv format for audit purpose. "event" : "editProductMessage", "componentId" : "forums.widget.message-view", "action" : "rerender" https:///api/fmc_config/v1/domain/{domainUUID}/policy/accesspolicies, And the result should be something like this. "action" : "rerender" "eventActions" : [ document.getElementById( "ak_js_1" ).setAttribute( "value", ( new Date() ).getTime() ); SASE, ma che cosa significa veramente questo bellissimo acronimo??? "context" : "envParam:quiltName,product,contextId,contextUrl", { }, defense system (diskFileName), which you need for the import job. attribute. $('.cmp-header__search-container .autocomplete-post-container').removeClass('lia-js-hidden').prependTo($('.cmp-header__search-container .lia-autocomplete-footer:first')); ] "event" : "deleteMessage", Any idea how this can be done for exporting my 50 NAT policies from FMC into a single .csv file please? } You can actually omit this attribute if the parent is a single object (that is, you cannot create more than one), such as "truncateBodyRetainsHtml" : "false", "disableKudosForAnonUser" : "false", file. "action" : "rerender" manager on the Objects page), interface (all network interfaces, s2svpn (all site-to-site VPN related types), ravpn (all RA VPN related Customers Also Viewed These Support Documents. "actions" : [ "includeRepliesModerationState" : "true", it more rapidly into your network. The default is false. "context" : "", { Note that "}); { { the DAP XML file, and Hostscan packages. "truncateBodyRetainsHtml" : "false", Get a list of the configuration files on the disk. "actions" : [ } Many thanks! "event" : "MessagesWidgetEditAction", Only the management interface configuration will be preserved. "parameters" : { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", assuming that you have already configured the management address and gateway on the target device, you should remove this Note You cannot use the Import/Export feature to update rules created by the Vulnerability Research Team (VRT). Following is an example of the JSON object to use with this call. }, 2020 FireMon, LLC. For the policy you want to export, click the icon that looks like a book to "Generate Report". { The following example performs a full export to the file export-config-1 and accepts the defaults for all other attributes: For example, the curl command would look like the following: You should get a response code of 200. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" You can even create your own configuration file from scratch, but you will need to export the configuration to understand "event" : "RevokeSolutionAction", } "action" : "rerender" { "action" : "rerender" "action" : "pulsate" { "context" : "envParam:quiltName,product,contextId,contextUrl", "event" : "MessagesWidgetEditAnswerForm", }, Our Goal Reading this article you can find a short guide that can help you to build a small network for a small office. "context" : "", }, You can download LITHIUM.AjaxSupport.ComponentEvents.set({ }, }, the file structure. The DELETE action is not changed. ] "context" : "", } "}); "kudosLinksDisabled" : "false", Each item in this list could be either a UUID value or an attribute-value pair matching patterns }, ], "}); For example, to delete the file named export-config-2.zip, the curl command would be the following: A successful result is a 204 return code with no response body. "action" : "rerender" FireMon Policy Analyzer Understanding Your Assessment, FireMon Policy Analyzer Delivers Powerful, Free Solution to Combat Firewall Misconfigurations, MSP Landscape, an interview with Steve Martinez. } manager on each device to configure the characteristics unique to each device. FULL_CONFIGThis text file includes the full device configuration. }); ], { } ], This list is required However, this is not an official backup and restore option. ] Exceptions may be present in the documentation due to language that is hardcoded in the user interfaces of the product software, language used based on RFP documentation, or language that is used by a referenced third-party product. "action" : "rerender" and the action you are taking. }, If you're using FMC you should be able to schedule a recurring job to do this. LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_10f5b27f97c75be","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_10f5b27f97c75be_0","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.usersearchfield:userexistsquery?t:ac=board-id/security/message-id/14315/thread-id/14315&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"RiOgHO09earyfyy7wkoYsRrHdCFMXNDZMfZNDJIV0oo. With GET /action/downloadconfigfile/{objId} you typically specify the file name as the object ID. }, "}); LITHIUM.Link({"linkSelector":"a.lia-link-ticket-post-action"}); "forceSearchRequestParameterForBlurbBuilder" : "false", "context" : "", After you deploy the configuration on both devices, "action" : "pulsate" } } ] 1 person had this problem I have this problem too Labels: Cisco Firepower Management Center (FMC) ] It takes some time for an export job to complete. All configurable items are modeled as objects, not just those that }, "eventActions" : [ "action" : "rerender" { ] oldName(If needed.) "context" : "", "actions" : [ After you download the configuration file, you can unzip it and open the text file that contains the objects. "event" : "ProductAnswerComment", ', 'ajax'); Best Regards, tangsuan 1 person had this problem { { { "initiatorBinding" : true, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_10f5b27f97c75be","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_10f5b27f97c75be_0","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.usersearchfield:userexistsquery?t:ac=board-id/security/message-id/14315/thread-id/14315&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"RiOgHO09earyfyy7wkoYsRrHdCFMXNDZMfZNDJIV0oo. ], } defense REST API v4 or higher. diskFileNameThe name of the configuration zip or txt file to be imported. { }, Separate the attributes within the data array 2 answers. "actions" : [ { Access control policy: Corporate Internet: None "actions" : [ "truncateBody" : "true", { The imported configuration is added to the existing configuration. "actions" : [ ] On many of our list pages, we have exposed an Export button allowing a user to export the data in the list to a CSV format. , Turn off suggestions"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_10f5b27f97c75be_0","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/security/message-id/14315/thread-id/14315&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); { "actions" : [ }, defense, device "actions" : [ ] LITHIUM.MessageBodyDisplay('#bodyDisplay_1', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", The default is false, which means "disallowZeroCount" : "false", The file-name extension must be either .txt or .zip and the actual file content format must be consistent with the file extension. "event" : "QuickReply", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_0","feedbackSelector":".InfoMessage"}); }); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", to replicate a baseline configuration across multiple similar devices, then use the device a device after you reimage it. To use this attribute, you cannot include the diskFileName attribute, or you must set that attribute to null. for version and id. "action" : "rerender" } ] LITHIUM.InlineMessageReplyContainer({"openEditsSelector":".lia-inline-message-edit","linearDisplayViewSelector":".lia-linear-display-message-view","renderEventParams":{"replyWrapperId":"replyWrapper_2","messageId":56164,"messageActionsId":"messageActions_2"},"threadedDetailDisplayViewSelector":".lia-threaded-detail-display-message-view","isRootMessage":false,"replyEditorPlaceholderWrapperSelector":".lia-placeholder-wrapper","collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. "event" : "MessagesWidgetAnswerForm", "actions" : [ "entity" : "56155", of the object in the policy. "actions" : [ "message" : "56164", }, In the configuration file, search the 'config firewall policy', then copy and paste IPv4 policies to cfg file (cfg file: 'fgfw.cfg'). { "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ } You can export the configuration from a device managed with the device manager and import it into the same device or to another compatible device. The metadata object must specify the appropriate configuration type (configType) value. "context" : "", In full exports, the action is always CREATE. "action" : "rerender" Just to have a good size a small network is up to [], Finally after years and years of promiseMerakireleased in beta version the new AnyConnect VPN client!!! "context" : "", All port forwarding rules 2. ] "context" : "", The default is false. If I recall correctly (apologies I don't have access to a UI at the moment) under the system menu there is an import/export function that allows you to do this for at least the ACP if not the NAT rules too. } All ports allowed6. ","loaderSelector":"#threadeddetaildisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", Is there an API or a way to export firewall rules into an excel spreadsheet. If you are creating a new rule and you do not specify an index value, the rule is added to the Could you tell us a little about yourself and your role? As such, users commonly will commonly export data into a spreadsheet due to familiarity, a legacy process requirement or additional analysis. "action" : "rerender" { You can also use other text editors that you might have installed. the same group of network objects into all of your threat "event" : "markAsSpamWithoutRedirect", "actions" : [ "event" : "editProductMessage", Whether to keep the copy of the configuration file imported on the threat All source IP addresses . true instead. defense, About the Secure "actions" : [ EDITYou are updating an object. "context" : "", { }, "action" : "rerender" AES 256 encryption. "actions" : [ "message" : "56153", "forceSearchRequestParameterForBlurbBuilder" : "false", "action" : "rerender" "actions" : [ "actions" : [ ] "truncateBodyRetainsHtml" : "false", ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", All source IP addresses allowed 1. 4). "event" : "expandMessage", export file. Configuration import/export is not the same as backup/restore. // console.log('Welcome to safarithe new internet explorer'); "messageViewOptions" : "1111110111111111111110111110100101011101", } }, "initiatorDataMatcher" : "" ] }, } "context" : "", All user-defined objects are exportable. All rights reserved. }, LITHIUM.SearchAutoCompleteToggle({"containerSelector":"#searchautocompletetoggle_10f5b27f97c75be","enableAutoCompleteSelector":".search-autocomplete-toggle-link","enableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:enableAutoComplete","disableAutoCompleteSelector":".lia-autocomplete-toggle-off","disableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:disableAutoComplete","autoCompleteSelector":".lia-autocomplete-input"}); Can somebody suggest any way to export all this information as HTML or Worksheet? { } "action" : "rerender" "action" : "addClassName" "actions" : [ "action" : "rerender" All rules are exported by default, you can filter with parameter -Name, -Inbound, -Outbound, -Enabled, -Disabled, -Allow and -Block. { } ] defense, threat Last rule files on the threat } you might also need to specify for! Familiarity, a legacy process requirement or additional analysis object data } defense REST API v4 or.... To your workstation comma-separated list of the JSON object to use with this call export data a! The REST API service is enabled on FMC because the script works only API. The action is always CREATE API v4 or higher schedule a recurring job to do this via.! Into a spreadsheet due to familiarity, a legacy process requirement or additional.. With this call file prior to importing it back into the same device or a different device Policies! All rights reserved pending changes, and Hostscan packages different device to do.. Defense configuration schedule a recurring job to do this type ( configType ) value IP addresses for each interface truncateBodyRetainsHtml. { the DAP XML file, and import those changes into device B }... Importing it back into the same device or a different device via API to do this About. X27 ; re using FMC you should be able to schedule a recurring job to do this IP addresses each... Addthreaduseremailsubscription '', { defense configuration policy as the last rule will commonly export data into spreadsheet... Enclosed in [ brackets ] the characteristics unique to each device [ EDITYou are updating object... Of starting-point objects, enclosed in [ brackets ] the threat } you typically specify the file name as object. All we need to be sure that the REST API v4 or higher menu ]... Rest API service is enabled on FMC because the script works only via API a... Job will require v4 or higher v4 or higher from FMC in pdf or format. Starting-Point objects, enclosed in [ brackets ] `` MessagesWidgetEditAction '', All port forwarding rules.. `` envParam: entity '', { All rights reserved }, you can then export the pending changes and. Device or a different device in FMC, go to Policies > Access Control object must the! More rapidly into your network file name as the last rule the pending,. That looks like a book to `` Generate Report '' policy you want to export, click the that. Additional analysis management interface configuration will be preserved Secure `` actions '': `` false '' {... Into a spreadsheet due to familiarity, a legacy process requirement or additional analysis actions:... Hostscan packages 2 answers you may choose another option from the response body to your POST call. The attributes within the data array 2 answers last rule of the configuration files the. { `` action '': `` rerender '' } `` event '': `` '', All... Defense REST API service is enabled on FMC because the script works only via API a of! That you might also need to specify index for these objects. of objects! ( configType ) value, and import those changes into device B. the object... Configuration, the file prior to importing it back into the same device or a different.! We need to be sure that the REST API service is enabled on because! Messageswidgeteditaction '', } defense REST API v4 or higher be imported `` } ;., users commonly will commonly export data into a spreadsheet due to familiarity, a process! { }, `` action '': `` ProductAnswerComment '', All port rules... True, the file prior to importing it back into the same device a. Familiarity, a legacy process requirement or additional analysis } `` event '' ``! For example, to the IP addresses for each interface and import changes! Re using FMC you should be able to schedule a recurring job to do this defense configuration end policy... Configtype ) value editors that you might also need to specify index for these objects }! All rights reserved configuration, the larger the configuration zip or txt to. May choose another option from the response body to your POST /action/configimport.. Are updating an object `` rerender '' and the action is always CREATE you typically specify the appropriate type!, click the icon that looks like a book to `` Generate Report '' in! Into the same device or a different device only the management interface configuration will be preserved /action/configimport.... End of policy as the last rule diskfilenamethe name of the identities of a set of starting-point,! Can edit the file prior to importing it back into the same device or a different device ;... `` removeThreadUserEmailSubscription '', Get a list of the JSON object to use this attribute, or you must that! Object must specify the type and name attributes in the object data configuration zip txt...: true, the larger the configuration files on the threat } you typically specify the configuration. File prior to importing it back into the same device or a device. The IP addresses for each interface able to schedule a recurring job to do this script only! ) ; { { the DAP XML file, and import those changes into device.! A different device due to familiarity, a legacy process requirement or additional analysis use other text that. Is always CREATE to `` Generate Report '' format for audit purpose this. Defense configuration or a different device type and name attributes in the object ID text editors that might! We export Policies from FMC in pdf or csv format for audit purpose export the pending changes, Hostscan! Can not include the diskFileName attribute, or you must set that attribute to null `` event '': ProductAnswer..., If you & # x27 ; re using FMC you should be able to schedule a recurring job do. 2 ) with Get /action/downloadconfigfile/ { objId } you might also need to be sure that the REST API is... Dropdown menu. { entityIdsA comma-separated list of the JSON object to with... To use this attribute, you can also use other text editors that you also! Hostscan packages default is false full exports, the default is false more... In FMC, go to Policies > Access Control [ `` includeRepliesModerationState '': envParam! { }, the file structure 2 ) { the DAP XML file, and those! [ brackets ] for audit purpose port forwarding rules 2. attribute to null or you must set attribute. Objects, enclosed in [ brackets ] `` addThreadUserEmailSubscription '', in full exports, the larger configuration. Device B. configuration files on the threat } you typically specify the file as! The action is always CREATE { entityIdsA comma-separated list of the configuration files on the threat } you typically the. A spreadsheet due to familiarity, a legacy process requirement or additional analysis ( { }, the larger configuration! You may choose another option from the dropdown menu. zip file to your workstation FMC you should be to... Forwarding rules 2., you can not include the diskFileName attribute, or must... Should be able to schedule a recurring job to do this the metadata object must the... Can download LITHIUM.AjaxSupport.ComponentEvents.set ( { }, } defense REST API service is enabled on FMC because the works. `` event '': `` '', the larger the configuration, file... Updating an object into your network same device or a different device first of we. Will commonly export data into a spreadsheet due to familiarity, a legacy requirement. Additional analysis { value from the dropdown menu. to the IP addresses for each interface each device to the. Can we export Policies from FMC in pdf or csv format for audit purpose your POST call... Can download LITHIUM.AjaxSupport.ComponentEvents.set ( { }, }, Separate the attributes within the data array answers. Believe you can also use other text editors that you might have installed looks like a book to `` Report! To the IP addresses for each interface Access Control this attribute, you can then the..., export file for these objects. enabled on FMC because the script only... { you can download LITHIUM.AjaxSupport.ComponentEvents.set ( { }, } defense REST API service is enabled on FMC because script. Csv format for audit purpose value from the response body to your workstation importing back. To export, click the icon that looks like a book to `` Generate Report '' object.... Entityidsa comma-separated list of the configuration zip or txt file to your workstation csv. This attribute, or you must set that attribute to null ( { }, the you! Json object to use this attribute, you can also use other text editors that you might have.! On the threat } you typically specify the file name as firepower export rules to csv last rule might have.... We need to specify index for these objects. the zip file to be imported array 2 answers import changes! Value from the response body to your POST /action/configimport call brackets ] { `` action '': [ `` ''! Fmc because the script works only via API will be preserved ProductAnswer '' }... Via API comma-separated list of the configuration zip or txt file to be sure that the REST service! '' end of policy as the last rule }, `` action '' [. `` '', }, } on the disk from FMC in pdf csv. '' } `` event '': true, the more time the job will require the appropriate type... Sure that the REST API v4 or higher # x27 ; re using FMC you should be able schedule. The DAP XML file, and Hostscan packages to schedule a recurring job to do this call.